FAM69C Antibody


Immunohistochemistry-Paraffin: FAM69C Antibody [NBP2-14666] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: FAM69C Antibody [NBP2-14666] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: FAM69C Antibody [NBP2-14666] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM69C Antibody [NBP2-14666] - Staining in human cerebral cortex and pancreas tissues using anti-FAM69C antibody. Corresponding FAM69C RNA-seq data are ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Validated by:

Orthogonal Strategies


Order Details

FAM69C Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: LSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCF
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM69C Protein (NBP2-14666PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM69C Antibody

  • C18orf51
  • FAM69C family with sequence similarity 69, member C


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for FAM69C Antibody (NBP2-14666) (0)

There are no publications for FAM69C Antibody (NBP2-14666).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM69C Antibody (NBP2-14666) (0)

There are no reviews for FAM69C Antibody (NBP2-14666). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM69C Antibody (NBP2-14666) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM69C Products

Array NBP2-14666

Diseases for FAM69C Antibody (NBP2-14666)

Discover more about diseases related to FAM69C Antibody (NBP2-14666).

Blogs on FAM69C

There are no specific blogs for FAM69C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM69C Antibody and receive a gift card or discount.


Gene Symbol FAM69C