FAM168A Recombinant Protein Antigen (NBP1-81525PEP)

Images

 
There are currently no images for FAM168A Protein (NBP1-81525PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FAM168A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM168A.

Source: E.coli

Amino Acid Sequence: MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPEFQFLHSAYATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTY

Protein/Peptide Type
Recombinant Protein Antigen
Gene
FAM168A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81525.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FAM168A Recombinant Protein Antigen

  • family with sequence similarity 168, member A
  • hypothetical protein LOC23201
  • KIAA0280TCRP1Tongue cancer chemotherapy resistance-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46366
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4029
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49799
Species: Hu
Applications: WB, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NB100-56696
Species: Hu
Applications: WB, Flow
NBP1-81525PEP
Species: Hu
Applications: AC

Publications for FAM168A Protein (NBP1-81525PEP) (0)

There are no publications for FAM168A Protein (NBP1-81525PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM168A Protein (NBP1-81525PEP) (0)

There are no reviews for FAM168A Protein (NBP1-81525PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for FAM168A Protein (NBP1-81525PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM168A Products

Related Products by Gene

Bioinformatics Tool for FAM168A Protein (NBP1-81525PEP)

Discover related pathways, diseases and genes to FAM168A Protein (NBP1-81525PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM168A

There are no specific blogs for FAM168A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FAM168A Antibody
NBP1-81525
FAM168A Antibody
NBP1-81525
FAM168A Antibody
NBP1-81525

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FAM168A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM168A