FAM136A Antibody - BSA Free

Images

 
Independent Antibodies: Western Blot: FAM136A Antibody [NBP1-82226] - Analysis using Anti-FAM136A antibody NBP1-82226 (A) shows similar pattern to independent antibody NBP1-82227 (B).
Immunocytochemistry/ Immunofluorescence: FAM136A Antibody [NBP1-82226] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM136A Antibody [NBP1-82226] - Staining of human thyroid gland shows strong cytoplasmic positivity in glanular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

FAM136A Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit FAM136A Antibody - BSA Free (NBP1-82226) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM136A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM136A Protein (NBP1-82226PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM136A Antibody - BSA Free

  • family with sequence similarity 136, member A
  • FLJ14668
  • hypothetical protein LOC84908

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB

Publications for FAM136A Antibody (NBP1-82226) (0)

There are no publications for FAM136A Antibody (NBP1-82226).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM136A Antibody (NBP1-82226) (0)

There are no reviews for FAM136A Antibody (NBP1-82226). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM136A Antibody (NBP1-82226) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM136A Products

Research Areas for FAM136A Antibody (NBP1-82226)

Find related products by research area.

Blogs on FAM136A

There are no specific blogs for FAM136A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM136A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM136A