FAKD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAKD3 Antibody [NBP2-57374] - Staining of human cell line U-2 OS shows localization to nucleus & mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAKD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: METLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEPSQLSNTSLVTALQALILLHVDPQSSLLLNLVAECQNRLRKGGMEVRNLCILGESLITLHSSGCVTLELIINQLQG
Specificity
Specificity of human FAKD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FASTKD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FAKD3 Antibody

  • FAST kinase domain-containing protein 3
  • FAST kinase domains 3
  • FLJ23274
  • MGC142123
  • MGC5297

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31323
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57917
Species: Hu
Applications: ICC/IF
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-57374
Species: Hu
Applications: ICC/IF

Publications for FAKD3 Antibody (NBP2-57374) (0)

There are no publications for FAKD3 Antibody (NBP2-57374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAKD3 Antibody (NBP2-57374) (0)

There are no reviews for FAKD3 Antibody (NBP2-57374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAKD3 Antibody (NBP2-57374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAKD3 Products

Array NBP2-57374

Bioinformatics Tool for FAKD3 Antibody (NBP2-57374)

Discover related pathways, diseases and genes to FAKD3 Antibody (NBP2-57374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAKD3 Antibody (NBP2-57374)

Discover more about diseases related to FAKD3 Antibody (NBP2-57374).
 

Pathways for FAKD3 Antibody (NBP2-57374)

View related products by pathway.

Research Areas for FAKD3 Antibody (NBP2-57374)

Find related products by research area.

Blogs on FAKD3

There are no specific blogs for FAKD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAKD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FASTKD3