ENTPD7 Antibody


Western Blot: ENTPD7 Antibody [NBP1-79317] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ENTPD7 Antibody Summary

Synthetic peptide directed towards the C terminal of human ENTPD7The immunogen for this antibody is ENTPD7. Peptide sequence EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ENTPD7 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ENTPD7 Antibody

  • DKFZp667O124
  • ectonucleoside triphosphate diphosphohydrolase 7
  • FLJ31830
  • LALP1
  • MGC141913
  • RP11-483F11.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Eq
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ENTPD7 Antibody (NBP1-79317) (0)

There are no publications for ENTPD7 Antibody (NBP1-79317).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENTPD7 Antibody (NBP1-79317) (0)

There are no reviews for ENTPD7 Antibody (NBP1-79317). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ENTPD7 Antibody (NBP1-79317) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ENTPD7 Products

Bioinformatics Tool for ENTPD7 Antibody (NBP1-79317)

Discover related pathways, diseases and genes to ENTPD7 Antibody (NBP1-79317). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENTPD7 Antibody (NBP1-79317)

Discover more about diseases related to ENTPD7 Antibody (NBP1-79317).

Pathways for ENTPD7 Antibody (NBP1-79317)

View related products by pathway.

Blogs on ENTPD7

There are no specific blogs for ENTPD7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ENTPD7 Antibody and receive a gift card or discount.


Gene Symbol ENTPD7