Recombinant Human ELMOD1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ELMOD1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-334 of Human ELMOD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ELMOD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELMOD1 Protein

  • DKFZp547C176
  • ELMO domain containing 1
  • ELMO domain-containing protein 1
  • ELMO/CED-12 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB100-875
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA

Publications for ELMOD1 Recombinant Protein (H00055531-P01) (0)

There are no publications for ELMOD1 Recombinant Protein (H00055531-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELMOD1 Recombinant Protein (H00055531-P01) (0)

There are no reviews for ELMOD1 Recombinant Protein (H00055531-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELMOD1 Recombinant Protein (H00055531-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELMOD1 Products

ELMOD1 H00055531-P01

Bioinformatics Tool for ELMOD1 Recombinant Protein (H00055531-P01)

Discover related pathways, diseases and genes to ELMOD1 Recombinant Protein (H00055531-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELMOD1 Recombinant Protein (H00055531-P01)

Discover more about diseases related to ELMOD1 Recombinant Protein (H00055531-P01).
 

Pathways for ELMOD1 Recombinant Protein (H00055531-P01)

View related products by pathway.

Research Areas for ELMOD1 Recombinant Protein (H00055531-P01)

Find related products by research area.

Blogs on ELMOD1

There are no specific blogs for ELMOD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ELMOD1 Antibody
NBP1-79667
Rac1 Antibody
NB100-91266
ELMO2 Antibody
NB100-879

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ELMOD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELMOD1