EIF1AD Antibody

Images

 
Immunohistochemistry-Paraffin: EIF1AD Antibody [NBP2-31728] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF1AD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF1AD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EIF1AD Protein (NBP2-31728PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF1AD Antibody

  • eukaryotic translation initiation factor 1A domain containing
  • Eukaryotic translation initiation factor 1A domain-containing protein
  • haponin
  • MGC11102
  • probable RNA-binding protein EIF1AD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-31728
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for EIF1AD Antibody (NBP2-31728) (0)

There are no publications for EIF1AD Antibody (NBP2-31728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF1AD Antibody (NBP2-31728) (0)

There are no reviews for EIF1AD Antibody (NBP2-31728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EIF1AD Antibody (NBP2-31728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF1AD Products

Bioinformatics Tool for EIF1AD Antibody (NBP2-31728)

Discover related pathways, diseases and genes to EIF1AD Antibody (NBP2-31728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF1AD Antibody (NBP2-31728)

Discover more about diseases related to EIF1AD Antibody (NBP2-31728).

Blogs on EIF1AD

There are no specific blogs for EIF1AD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF1AD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF1AD
Uniprot