Recombinant Human DTX3L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DTX3L Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 3 - 110 of Human DTX3L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE

Protein/Peptide Type
Partial Recombinant Protein
Gene
DTX3L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DTX3L Protein

  • BBAPEC 6.3.2.-
  • B-lymphoma- and BAL-associated protein
  • deltex 3-like (Drosophila)
  • E3 ubiquitin-protein ligase DTX3L
  • Protein deltex-3-like
  • rhysin 2
  • rhysin2
  • Rhysin-2

Background

DTX3L - deltex 3-like (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF2988
Species: Mu, Rt
Applications: WB
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-31789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP2-37412
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBL1-11569
Species: Hu
NBP2-10888
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for DTX3L Partial Recombinant Protein (H00151636-Q01) (0)

There are no publications for DTX3L Partial Recombinant Protein (H00151636-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX3L Partial Recombinant Protein (H00151636-Q01) (0)

There are no reviews for DTX3L Partial Recombinant Protein (H00151636-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DTX3L Partial Recombinant Protein (H00151636-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DTX3L Products

Bioinformatics Tool for DTX3L Partial Recombinant Protein (H00151636-Q01)

Discover related pathways, diseases and genes to DTX3L Partial Recombinant Protein (H00151636-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX3L Partial Recombinant Protein (H00151636-Q01)

Discover more about diseases related to DTX3L Partial Recombinant Protein (H00151636-Q01).
 

Pathways for DTX3L Partial Recombinant Protein (H00151636-Q01)

View related products by pathway.

Research Areas for DTX3L Partial Recombinant Protein (H00151636-Q01)

Find related products by research area.

Blogs on DTX3L

There are no specific blogs for DTX3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
DTX3L Antibody
NBP1-88699

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DTX3L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX3L