DNAJC5B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DNAJC5B Antibody [NBP2-69037] - Staining of human cell line RPTEC TERT1 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC5B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC5B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
DNAJC5B Recombinant Protein Antigen (NBP2-69037PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for DNAJC5B Antibody

  • Beta cysteine string protein
  • beta-CSP
  • CSP-beta
  • DnaJ (Hsp40) homolog, subfamily C, member 5 beta
  • dnaJ homolog subfamily C member 5B
  • dnaJ homolog subfamily C member X
  • MGC26226

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2720
Species: Hu
Applications: WB, IHC

Publications for DNAJC5B Antibody (NBP2-69037) (0)

There are no publications for DNAJC5B Antibody (NBP2-69037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC5B Antibody (NBP2-69037) (0)

There are no reviews for DNAJC5B Antibody (NBP2-69037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DNAJC5B Antibody (NBP2-69037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAJC5B Products

Bioinformatics Tool for DNAJC5B Antibody (NBP2-69037)

Discover related pathways, diseases and genes to DNAJC5B Antibody (NBP2-69037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC5B Antibody (NBP2-69037)

Discover more about diseases related to DNAJC5B Antibody (NBP2-69037).
 

Pathways for DNAJC5B Antibody (NBP2-69037)

View related products by pathway.

Blogs on DNAJC5B

There are no specific blogs for DNAJC5B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC5B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC5B