DNAH1 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAH1 Antibody [NBP1-90491] - Staining of human fallopian tube shows membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH1 Protein (NBP1-90491PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAH1 Antibody

  • axonemal beta dynein heavy chain 1
  • axonemal, heavy polypeptide 1
  • ciliary dynein heavy chain 1
  • DNAH1 variant protein
  • DNAHC1
  • dynein heavy chain 1, axonemal
  • dynein, axonemal, heavy chain 1
  • HDHC7
  • heat shock regulated 1
  • HL11
  • HL-11
  • HSRF-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83186
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93336
Species: Hu
Applications: WB, IP
NBP1-98369
Species: Mu
Applications: WB
NBP2-49441
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-32114
Species: Hu, Mu
Applications: WB, IP

Publications for DNAH1 Antibody (NBP1-90491) (0)

There are no publications for DNAH1 Antibody (NBP1-90491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAH1 Antibody (NBP1-90491) (0)

There are no reviews for DNAH1 Antibody (NBP1-90491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH1 Antibody (NBP1-90491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAH1 Products

DNAH1 NBP1-90491

Bioinformatics Tool for DNAH1 Antibody (NBP1-90491)

Discover related pathways, diseases and genes to DNAH1 Antibody (NBP1-90491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAH1 Antibody (NBP1-90491)

Discover more about diseases related to DNAH1 Antibody (NBP1-90491).

Blogs on DNAH1

There are no specific blogs for DNAH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH1