DNAH1 Antibody

Product Discontinued

DNAH1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAH1 Antibody

• axonemal beta dynein heavy chain 1
• axonemal, heavy polypeptide 1
• ciliary dynein heavy chain 1
• DNAH1 variant protein
• DNAHC1
• dynein heavy chain 1, axonemal
• dynein, axonemal, heavy chain 1
• HDHC7
• heat shock regulated 1
• HL11
• HL-11
• HSRF-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAH1