DjC9 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DjC9 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJC9.
  
  

  Source: E. coli

  Amino Acid Sequence: TVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DNAJC9
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87903.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DjC9 Recombinant Protein Antigen

• DnaJ (Hsp40) homolog, subfamily C, member 9
• dnaJ homolog subfamily C member 9

Background

DjC9 (DnaJ subfamily C member 9) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. DjC9 is part of subfamily C that bears only the J-domain. DjC9 has been shown to interact with HSP70 through its J domain and activate its ATPase activity. DjC9 is also known as DnaJ protein SB73, HDJC9,DNAJC9,JDD1, and KIAA0974.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC9