DIA1R Antibody

Images

 
Western Blot: DIA1R Antibody [NBP2-82853] - Host: Rabbit. Target Name: CXorf36. Sample Type: Hela Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIA1R Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DIA1R. Peptide sequence: DKQEGSQEANRAGENKDIFSCLVSGCQAQLPSCESISEKQSLVLVCQKLL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DIPK2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIA1R Antibody

  • 4930578C19Rik
  • bA435K1.1
  • chromosome X open reading frame 36
  • CXorf36
  • EPQL1862
  • PRO3743

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-02705
Species: Ca, Hu, Pm, Pm
Applications: Flow, IHC, IHC-P, WB
NBP1-87486
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-82853
Species: Hu
Applications: WB

Publications for DIA1R Antibody (NBP2-82853) (0)

There are no publications for DIA1R Antibody (NBP2-82853).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIA1R Antibody (NBP2-82853) (0)

There are no reviews for DIA1R Antibody (NBP2-82853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIA1R Antibody (NBP2-82853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIA1R Products

Array NBP2-82853

Bioinformatics Tool for DIA1R Antibody (NBP2-82853)

Discover related pathways, diseases and genes to DIA1R Antibody (NBP2-82853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIA1R Antibody (NBP2-82853)

Discover more about diseases related to DIA1R Antibody (NBP2-82853).
 

Pathways for DIA1R Antibody (NBP2-82853)

View related products by pathway.

Blogs on DIA1R

There are no specific blogs for DIA1R, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIA1R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIPK2B