![Western Blot: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MOLT-4](http://images.novusbio.com/fullsize/DENN-MADD-Domain-Containing-2D-Antibody-Western-Blot-NBP2-30995-img0002.jpg "Western Blot: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MOLT-4")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DENND2D |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelium.](http://images.novusbio.com/fullsize/DENN-MADD-Domain-Containing-2D-Antibody-Immunohistochemistry-NBP2-30995-img0001.jpg "Immunohistochemistry: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelium.")
![Simple Western: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Simple Western lane view shows a specific band for DENN/MADD Domain Containing 2D in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/DENN-MADD-Domain-Containing-2D-Antibody-Simple-Western-NBP2-30995-img0003.jpg "Simple Western: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Simple Western lane view shows a specific band for DENN/MADD Domain Containing 2D in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Electropherogram image of the corresponding Simple Western lane view. DENN/MADD Domain Containing 2D antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.](http://images.novusbio.com/fullsize/DENN-MADD-Domain-Containing-2D-Antibody-Simple-Western-NBP2-30995-img0004.jpg "Simple Western: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Electropherogram image of the corresponding Simple Western lane view. DENN/MADD Domain Containing 2D antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Immunohistochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/FGF_R3_MAB7662_Immunohistochemistry_23319.jpg)
![Flow Cytometry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/mab7662_human-fgf-r3-iiic-mab-clone-136312-flow-cytometry-2112202112199.jpg)
![Immunocytochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)](https://images.novusbio.com/images2/mab7662_human-fgf-r3-iiic-mab-clone-136312-immunocytochemistry-186202172236.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")