DENN/MADD Domain Containing 2D Antibody

Images

 
Western Blot: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MOLT-4
Immunohistochemistry: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelium.
Simple Western: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Simple Western lane view shows a specific band for DENN/MADD Domain Containing 2D in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed ...read more
Simple Western: DENN/MADD Domain Containing 2D Antibody [NBP2-30995] - Electropherogram image of the corresponding Simple Western lane view. DENN/MADD Domain Containing 2D antibody was used at 1:25 dilution on MOLT-4 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DENN/MADD Domain Containing 2D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DENND2D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DENN/MADD Domain Containing 2D Protein (NBP2-30995PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DENN/MADD Domain Containing 2D Antibody

  • DENN Domain-Containing Protein 2D
  • DENND2D
  • RP5-1180E21.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58599
Species: Hu
Applications: ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-77314
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for DENN/MADD Domain Containing 2D Antibody (NBP2-30995) (0)

There are no publications for DENN/MADD Domain Containing 2D Antibody (NBP2-30995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DENN/MADD Domain Containing 2D Antibody (NBP2-30995) (0)

There are no reviews for DENN/MADD Domain Containing 2D Antibody (NBP2-30995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DENN/MADD Domain Containing 2D Antibody (NBP2-30995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DENN/MADD Domain Containing 2D Products

Bioinformatics Tool for DENN/MADD Domain Containing 2D Antibody (NBP2-30995)

Discover related pathways, diseases and genes to DENN/MADD Domain Containing 2D Antibody (NBP2-30995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DENN/MADD Domain Containing 2D Antibody (NBP2-30995)

Discover more about diseases related to DENN/MADD Domain Containing 2D Antibody (NBP2-30995).
 

Pathways for DENN/MADD Domain Containing 2D Antibody (NBP2-30995)

View related products by pathway.

Blogs on DENN/MADD Domain Containing 2D

There are no specific blogs for DENN/MADD Domain Containing 2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DENN/MADD Domain Containing 2D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DENND2D
Uniprot