DEGS2 Antibody

Immunocytochemistry/Immunofluorescence: DEGS2 Antibody [NBP2-13912] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Discontinued

DEGS2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEGS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DEGS2 Antibody

• C14orf66
• chromosome 14 open reading frame 66
• Degenerative spermatocyte homolog 2
• degenerative spermatocyte homolog 2, lipid desaturase (Drosophila)
• DES2sphingolipid delta(4)-desaturase/C4-hydroxylase DES2
• EC 1.14
• FADS8
• sphingolipid C4-hydroxylase/delta 4-desaturase
• sphingolipid delta 4 desaturase/C-4 hydroxylase

Background

The DEGS2 gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hy

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEGS2