DEFB107A Antibody

Images

 
Immunohistochemistry: DEFB107A Antibody [NBP2-59793] - Human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DEFB107A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acid sequence: QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Specificity
Specificity of human DEFB107A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DEFB107A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for DEFB107A Antibody

  • BD-7
  • Beta-Defensin 107
  • Beta-Defensin 7
  • DEFB107
  • DEFB107A DEFB107B
  • DEFB7
  • DEFB-7
  • Defensin Beta 107A
  • Defensin, Beta 107A
  • Defensin, Beta 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-59793
Species: Hu
Applications: IHC, IHC-P

Publications for DEFB107A Antibody (NBP2-59793) (0)

There are no publications for DEFB107A Antibody (NBP2-59793).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEFB107A Antibody (NBP2-59793) (0)

There are no reviews for DEFB107A Antibody (NBP2-59793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DEFB107A Antibody (NBP2-59793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DEFB107A Products

Bioinformatics Tool for DEFB107A Antibody (NBP2-59793)

Discover related pathways, diseases and genes to DEFB107A Antibody (NBP2-59793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DEFB107A

There are no specific blogs for DEFB107A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DEFB107A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DEFB107A