CXorf56/MRX107 Antibody


Western Blot: CXorf56 Antibody [NBP1-82097] - Analysis in control (vector only transfected HEK293T lysate) and CXorf56 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: CXorf56 Antibody [NBP1-82097] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CXorf56/MRX107 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKD
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXorf56/MRX107 Recombinant Protein Antigen (NBP1-82097PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CXorf56/MRX107 Antibody

  • chromosome X open reading frame 56
  • FLJ22965
  • hypothetical protein LOC63932


While this gene is well-supported by transcript data, no functional information on its protein products is currentlyavailable. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CXorf56/MRX107 Antibody (NBP1-82097) (0)

There are no publications for CXorf56/MRX107 Antibody (NBP1-82097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf56/MRX107 Antibody (NBP1-82097) (0)

There are no reviews for CXorf56/MRX107 Antibody (NBP1-82097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXorf56/MRX107 Antibody (NBP1-82097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CXorf56/MRX107 Products

Bioinformatics Tool for CXorf56/MRX107 Antibody (NBP1-82097)

Discover related pathways, diseases and genes to CXorf56/MRX107 Antibody (NBP1-82097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXorf56/MRX107 Antibody (NBP1-82097)

Discover more about diseases related to CXorf56/MRX107 Antibody (NBP1-82097).

Blogs on CXorf56/MRX107

There are no specific blogs for CXorf56/MRX107, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CXorf56/MRX107 Antibody and receive a gift card or discount.


Gene Symbol CXORF56