CTDSPL2 Antibody - BSA Free

Western Blot: CTDSPL2 Antibody [NBP1-91814] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: CTDSPL2 Antibody [NBP1-91814] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CTDSPL2 Antibody [NBP1-91814] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Western Blot: CTDSPL2 Antibody [NBP1-91814] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Staining of human testis shows moderate nuclear/cytoplasmic positivity in Leydig cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Staining of human colon shows moderate membranous/cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Staining of human skin shows strong membranous/cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTDSPL2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CTDSPL2 Antibody - BSA Free (NBP1-91814) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CTDSPL2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRV
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTDSPL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CTDSPL2 Protein (NBP1-91814PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CTDSPL2 Antibody - BSA Free

• CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase like 2
• CTD small phosphatase-like protein 2
• CTDSP-like 2
• EC 3.1.3
• EC 3.1.3.-
• EC 3.1.3.16
• FLJ10523
• HSPC129

Background

CTDSPL2, also known as CTD small phosphatase-like protein 2, is a 54kDa 466 amino acid protein with a shorter 45kDa 394 isoform. Current research on CTDSPL2 is being conducted in relation to sarcoma. The gene is linked to the RNA processing pathway where it interacts with UBC and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CTDSPL2 Antibody (NBP1-91814)(1)

Publication using NBP1-91814

• Wang P, Zou K, Cao J et al. Protein phosphatase SCP4 regulates cartilage development and endochondral osteogenesis via FoxO3a dephosphorylation Cell Proliferation 2024-06-17 [PMID: 38886174]

Bioinformatics

• Gene Symbol: CTDSPL2