CSN7b Antibody


Western Blot: CSN7b Antibody [NBP1-85433] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CSN7b Antibody [NBP1-85433] - Staining of human testis shows shows strong cytoplasmic positivity.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CSN7b Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSV
Specificity of human CSN7b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CSN7b Protein (NBP1-85433PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CSN7b Antibody

  • Arabidopsis, homolog) subunit 7B
  • COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis)
  • COP9 signalosome complex subunit 7b
  • CSN7BMGC111077
  • FLJ12612
  • Signalosome subunit 7b


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CSN7b Antibody (NBP1-85433) (0)

There are no publications for CSN7b Antibody (NBP1-85433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSN7b Antibody (NBP1-85433) (0)

There are no reviews for CSN7b Antibody (NBP1-85433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSN7b Antibody (NBP1-85433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CSN7b Products

Bioinformatics Tool for CSN7b Antibody (NBP1-85433)

Discover related pathways, diseases and genes to CSN7b Antibody (NBP1-85433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CSN7b Antibody (NBP1-85433)

Find related products by research area.

Blogs on CSN7b

There are no specific blogs for CSN7b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CSN7b Antibody and receive a gift card or discount.


Gene Symbol COPS7B