CPNE5 Antibody

Images

 
Western Blot: CPNE5 Antibody [NBP1-79677] - Mouse Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPNE5 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human Cpne5The immunogen for this antibody is Cpne5. Peptide sequence SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPNE5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Cpne5 and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CPNE5 Antibody

  • copine VKIAA1599CPN5COPN5
  • copine-5
  • DKFZp666C234

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13958
Species: Hu
Applications: IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for CPNE5 Antibody (NBP1-79677) (0)

There are no publications for CPNE5 Antibody (NBP1-79677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE5 Antibody (NBP1-79677) (0)

There are no reviews for CPNE5 Antibody (NBP1-79677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE5 Antibody (NBP1-79677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPNE5 Products

Bioinformatics Tool for CPNE5 Antibody (NBP1-79677)

Discover related pathways, diseases and genes to CPNE5 Antibody (NBP1-79677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE5 Antibody (NBP1-79677)

Discover more about diseases related to CPNE5 Antibody (NBP1-79677).
 

Pathways for CPNE5 Antibody (NBP1-79677)

View related products by pathway.

Blogs on CPNE5

There are no specific blogs for CPNE5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE5
Uniprot