CNFN Antibody

Images

 
Immunohistochemistry-Paraffin: CNFN Antibody [NBP2-14668] - Staining of human cervix, uterine shows distinct membranous positivity in superficial layer of squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNFN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLAC RISDDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNFN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNFN Protein (NBP2-14668PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNFN Antibody

  • CNFN cornifelin
  • PLAC8L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNFN Antibody (NBP2-14668) (0)

There are no publications for CNFN Antibody (NBP2-14668).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNFN Antibody (NBP2-14668) (0)

There are no reviews for CNFN Antibody (NBP2-14668). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNFN Antibody (NBP2-14668) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNFN Products

CNFN NBP2-14668

Bioinformatics Tool for CNFN Antibody (NBP2-14668)

Discover related pathways, diseases and genes to CNFN Antibody (NBP2-14668). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNFN Antibody (NBP2-14668)

Discover more about diseases related to CNFN Antibody (NBP2-14668).

Blogs on CNFN

There are no specific blogs for CNFN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNFN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNFN