CEP78 Antibody

Images

 
Immunohistochemistry-Paraffin: CEP78 Antibody [NBP2-48920] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP78 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP78
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CEP78 Recombinant Protein Antigen (NBP2-48920PEP)
Publications
Read Publication using
NBP2-48920 in the following applications:

Reactivity Notes

Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP78 Antibody

  • C9orf81
  • centrosomal protein 78kDa
  • centrosomal protein of 78 kDa
  • Cep78
  • chromosome 9 open reading frame 81
  • FLJ12643
  • FLJ52093
  • IP63
  • MGC135040

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14801
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP3-05075
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004957-M01
Species: Ce, Hu
Applications: ELISA, ICC/IF, IHC, WB
NBP2-48920
Species: Hu
Applications: IHC, IHC-P

Publications for CEP78 Antibody (NBP2-48920)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CEP78 Antibody (NBP2-48920) (0)

There are no reviews for CEP78 Antibody (NBP2-48920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CEP78 Antibody (NBP2-48920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CEP78 Products

Bioinformatics Tool for CEP78 Antibody (NBP2-48920)

Discover related pathways, diseases and genes to CEP78 Antibody (NBP2-48920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP78 Antibody (NBP2-48920)

Discover more about diseases related to CEP78 Antibody (NBP2-48920).

Blogs on CEP78

There are no specific blogs for CEP78, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP78 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP78