CCDC94 Antibody


Independent Antibodies: Western Blot: CCDC94 Antibody [NBP2-55866] - Analysis using Anti-CCDC94 antibody NBP2-55866 (A) shows similar pattern to independent antibody NBP1-91766 (B).
Immunocytochemistry/ Immunofluorescence: CCDC94 Antibody [NBP2-55866] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Validated by:

Independent Antibodies


Order Details

CCDC94 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEI
Specificity of human CCDC94 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC94 Recombinant Protein Antigen (NBP2-55866PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CCDC94 Antibody

  • coiled-coil domain containing 94
  • coiled-coil domain-containing protein 94
  • FLJ10374


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for CCDC94 Antibody (NBP2-55866) (0)

There are no publications for CCDC94 Antibody (NBP2-55866).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC94 Antibody (NBP2-55866) (0)

There are no reviews for CCDC94 Antibody (NBP2-55866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC94 Antibody (NBP2-55866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CCDC94 Antibody (NBP2-55866)

Discover related pathways, diseases and genes to CCDC94 Antibody (NBP2-55866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC94 Antibody (NBP2-55866)

Discover more about diseases related to CCDC94 Antibody (NBP2-55866).

Pathways for CCDC94 Antibody (NBP2-55866)

View related products by pathway.

Blogs on CCDC94

There are no specific blogs for CCDC94, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC94 Antibody and receive a gift card or discount.


Gene Symbol CCDC94