Recombinant Human CCDC4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CCDC4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 416 of Human CCDC4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQGAPRARFGSRTPPAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLRGTASFRSVSPSVISFHRIGCGSPRTSVQPSVF

Protein/Peptide Type
Recombinant Protein
Gene
BEND4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCDC4 Protein

  • BEN domain containing 4
  • BEN domain-containing protein 4
  • CCDC4
  • coiled-coil domain containing 4
  • coiled-coil domain-containing protein 4
  • FLJ35632
  • FLJ43965

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7707-NP
Species: Hu
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP1-80285
Species: Mu
Applications: WB
NBP2-48570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00338917-T01
Species: Hu
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59160
Species: Hu
Applications: WB
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
AF6108
Species: Hu
Applications: IHC
NBP2-02117
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00389206-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CCDC4 Recombinant Protein (H00389206-P01) (0)

There are no publications for CCDC4 Recombinant Protein (H00389206-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC4 Recombinant Protein (H00389206-P01) (0)

There are no reviews for CCDC4 Recombinant Protein (H00389206-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC4 Recombinant Protein (H00389206-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCDC4 Products

Bioinformatics Tool for CCDC4 Recombinant Protein (H00389206-P01)

Discover related pathways, diseases and genes to CCDC4 Recombinant Protein (H00389206-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC4 Recombinant Protein (H00389206-P01)

Discover more about diseases related to CCDC4 Recombinant Protein (H00389206-P01).
 

Pathways for CCDC4 Recombinant Protein (H00389206-P01)

View related products by pathway.

PTMs for CCDC4 Recombinant Protein (H00389206-P01)

Learn more about PTMs related to CCDC4 Recombinant Protein (H00389206-P01).

Blogs on CCDC4

There are no specific blogs for CCDC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GLP-1R Antibody
NBP1-97308
CCDC4 Antibody
NBP1-88163

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCDC4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BEND4