Recombinant Human CCDC12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CCDC12 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 166 of Human CCDC12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CCDC12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCDC12 Protein

  • coiled-coil domain containing 12
  • coiled-coil domain-containing protein 12
  • FLJ39430
  • FLJ40801
  • MGC23918

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-82773
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-94016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00151903-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CCDC12 Recombinant Protein (H00151903-P01) (0)

There are no publications for CCDC12 Recombinant Protein (H00151903-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC12 Recombinant Protein (H00151903-P01) (0)

There are no reviews for CCDC12 Recombinant Protein (H00151903-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC12 Recombinant Protein (H00151903-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCDC12 Products

Bioinformatics Tool for CCDC12 Recombinant Protein (H00151903-P01)

Discover related pathways, diseases and genes to CCDC12 Recombinant Protein (H00151903-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC12 Recombinant Protein (H00151903-P01)

Discover more about diseases related to CCDC12 Recombinant Protein (H00151903-P01).
 

Pathways for CCDC12 Recombinant Protein (H00151903-P01)

View related products by pathway.

PTMs for CCDC12 Recombinant Protein (H00151903-P01)

Learn more about PTMs related to CCDC12 Recombinant Protein (H00151903-P01).

Blogs on CCDC12

There are no specific blogs for CCDC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CCDC12 Antibody
NBP2-30374

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCDC12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC12