CAMSAP3 Antibody

Images

 
Western Blot: CAMSAP3 Antibody [NBP2-84587] - Host: Rabbit. Target Name: CAMSAP3. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAMSAP3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAMSAP3. Peptide sequence: APSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSN The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (93%), Rabbit (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
CAMSAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAMSAP3 Antibody

  • calmodulin regulated spectrin-associated protein family, member 3
  • calmodulin-regulated spectrin-associated protein 3
  • KIAA1543
  • NEZHA
  • protein Nezha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-21402
Species: Hu, Rt
Applications: WB, ICC/IF, IP, KD
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-17058
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-85045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-26645
Species: Hu, Rt
Applications: WB, IP
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for CAMSAP3 Antibody (NBP2-84587) (0)

There are no publications for CAMSAP3 Antibody (NBP2-84587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMSAP3 Antibody (NBP2-84587) (0)

There are no reviews for CAMSAP3 Antibody (NBP2-84587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAMSAP3 Antibody (NBP2-84587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CAMSAP3 Products

Bioinformatics Tool for CAMSAP3 Antibody (NBP2-84587)

Discover related pathways, diseases and genes to CAMSAP3 Antibody (NBP2-84587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CAMSAP3 Antibody (NBP2-84587)

View related products by pathway.

Blogs on CAMSAP3

There are no specific blogs for CAMSAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAMSAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMSAP3