C7orf26 Antibody

Images

 
Western Blot: C7orf26 Antibody [NBP2-14764] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: C7orf26 Antibody [NBP2-14764] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C7orf26 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: AKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C7orf26
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in Immunoprecipitation reported in scientific literature (PMID:35085500) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C7orf26 Protein (NBP2-14764PEP)
Publications
Read Publication using
NBP2-14764 in the following applications:

  • IP
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C7orf26 Antibody

  • C7orf26 chromosome 7 open reading frame 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C7orf26 Antibody (NBP2-14764)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for C7orf26 Antibody (NBP2-14764) (0)

There are no reviews for C7orf26 Antibody (NBP2-14764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C7orf26 Antibody (NBP2-14764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C7orf26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C7orf26