C6orf52 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C6orf52 Antibody [NBP2-14727] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: C6orf52 Antibody [NBP2-14727] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C6orf52 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: HETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEESNQEFMVKSEELYDSLMNCHW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6orf52
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C6orf52 Protein (NBP2-14727PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C6orf52 Antibody

  • C6orf52 chromosome 6 open reading frame 52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77068
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP2-14727
Species: Hu
Applications: ICC/IF, IHC

Publications for C6orf52 Antibody (NBP2-14727) (0)

There are no publications for C6orf52 Antibody (NBP2-14727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C6orf52 Antibody (NBP2-14727) (0)

There are no reviews for C6orf52 Antibody (NBP2-14727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C6orf52 Antibody (NBP2-14727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C6orf52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6orf52