C2orf76 Antibody

Western Blot: C2orf76 Antibody [NBP1-91732] - Analysis in control (vector only transfected HEK293T lysate) and C2orf76 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: C2orf76 Antibody [NBP1-91732] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C2orf76 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDVPLRTNLPPPFRNYKYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C2ORF76
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  C2orf76 Protein (NBP1-91732PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C2orf76 Antibody

• AIM29
• chromosome 2 open reading frame 76
• hypothetical protein LOC130355
• LOC130355
• MGC104437

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C2ORF76