C16orf74 Antibody


Immunocytochemistry/ Immunofluorescence: C16orf74 Antibody [NBP2-14680] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & centrosome.
Immunohistochemistry-Paraffin: C16orf74 Antibody [NBP2-14680] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

C16orf74 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDP
Specificity of human C16orf74 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C16orf74 Protein (NBP2-14680PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C16orf74 Antibody

  • C16orf74 chromosome 16 open reading frame 74


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C16orf74 Antibody (NBP2-14680) (0)

There are no publications for C16orf74 Antibody (NBP2-14680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C16orf74 Antibody (NBP2-14680) (0)

There are no reviews for C16orf74 Antibody (NBP2-14680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C16orf74 Antibody (NBP2-14680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C16orf74 Products

C16orf74 NBP2-14680

Bioinformatics Tool for C16orf74 Antibody (NBP2-14680)

Discover related pathways, diseases and genes to C16orf74 Antibody (NBP2-14680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C16orf74 Antibody (NBP2-14680)

Discover more about diseases related to C16orf74 Antibody (NBP2-14680).

Blogs on C16orf74

There are no specific blogs for C16orf74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C16orf74 Antibody and receive a gift card or discount.


Gene Symbol C16orf74