BTBD1 Antibody - BSA Free

Western Blot: BTBD1 Antibody [NBP2-87087] - Host: Rabbit. Target Name: BTBD1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

Western Blot: BTBD1 Antibody [NBP2-87087] - WB Suggested Anti-BTBD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysateBTBD1 is supported by BioGPS gene expression data to be expressed in 721_B

Western Blot: BTBD1 Antibody [NBP2-87087] - Host: Rabbit. Target Name: BTBD1. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Western Blot: BTBD1 Antibody [NBP2-87087] - Host: Rabbit. Target Name: BTBD1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BTBD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BTBD1 Antibody - BSA Free (NBP2-87087) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human BTBD1. Peptide sequence: LPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTBD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BTBD1 Antibody - BSA Free

• BTB (POZ) domain containing 1
• BTB domain containing 1
• BTB/POZ domain-containing protein 1
• C15orf1
• HCV NS5A-transactivated protein 8
• Hepatitis C virus NS5A-transactivated protein 8
• NS5ATP8

Background

The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTBD1