We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

BLOC1S1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related BLOC1S1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-88583PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BLOC1S1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BLOC1S1.

Source: E. coli

Amino Acid Sequence: LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BLOC1S1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88583.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BLOC1S1 Recombinant Protein Antigen

  • biogenesis of lysosomal organelles complex-1, subunit 1
  • BLOC subunit 1
  • BLOC-1 subunit 1
  • BLOS1MICoA
  • FLJ39337
  • FLJ97089
  • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1
  • GCN5 general control of amino-acid synthesis 5-like 1 (yeast)
  • GCN5 general control of amino-acid synthesis 5-like 1
  • GCN5L1biogenesis of lysosome-related organelles complex 1 subunit 1
  • GCN5-like protein 1
  • MGC87455
  • MTA1-interacting coactivator
  • Protein RT14
  • RT14

Background

BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85299
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-05039
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-03343
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
MAB7795
Species: Hu, Mu
Applications: WB
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46086
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-52563
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-46083
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
H00055330-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-03343
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NB600-260
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-88583PEP
Species: Hu
Applications: AC

Publications for BLOC1S1 Recombinant Protein Antigen (NBP1-88583PEP) (0)

There are no publications for BLOC1S1 Recombinant Protein Antigen (NBP1-88583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLOC1S1 Recombinant Protein Antigen (NBP1-88583PEP) (0)

There are no reviews for BLOC1S1 Recombinant Protein Antigen (NBP1-88583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BLOC1S1 Recombinant Protein Antigen (NBP1-88583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BLOC1S1 Products

Array NBP1-88583PEP

Research Areas for BLOC1S1 Recombinant Protein Antigen (NBP1-88583PEP)

Find related products by research area.

Blogs on BLOC1S1

There are no specific blogs for BLOC1S1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BLOC1S1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BLOC1S1