beta-Arrestin 2 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related beta-Arrestin 2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-79278
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

beta-Arrestin 2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL.
Predicted Species
Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Zebrafish (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARRB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ARRB2 and was validated on Western Blot and immunohistochemistry .
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for beta-Arrestin 2 Antibody

  • ARB2
  • ARR2
  • ARRB2
  • arrestin 3
  • Arrestin beta-2
  • arrestin, beta 2
  • BARR2
  • betaArrestin 2
  • beta-Arrestin 2
  • beta-arrestin-2
  • DKFZp686L0365

Background

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB45601
Species: Hu
Applications: IHC, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
NBP1-79278
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ze
Applications: WB, IHC

Publications for beta-Arrestin 2 Antibody (NBP1-79278) (0)

There are no publications for beta-Arrestin 2 Antibody (NBP1-79278).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Arrestin 2 Antibody (NBP1-79278) (0)

There are no reviews for beta-Arrestin 2 Antibody (NBP1-79278). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-Arrestin 2 Antibody (NBP1-79278). (Showing 1 - 1 of 1 FAQ).

  1. We are going to order NBP1-79278 for Western Blot detection of Zebrafish embryonic Arrb2. Does this Ab also recognize Arrb1 due to their conserved sequences? Can you please tell me the exact peptide you used to generate the Ab for human ARRB2?
    • Unfortunately, our anti-hArrb2 antibody has not been tested for potential cross-reactivity to hArrb1. Based on the sequence of the peptide immunogen used to generate this anti-hARRB2 antibody, it is 100% homologous to all three isoforms of the human ARRB2 protein (https://www.uniprot.org/uniprotkb/P32121/entry) and 86% homologous to either isoform of the human ARRB1 protein (https://www.uniprot.org/uniprotkb/P49407/entry). Synthetic peptide directed towards the middle region of human ARRB2. Peptide sequence RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Arrestin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARRB2
Uniprot