beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

Western Blot: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP1-59863] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to B4GALT2(UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: B4GALT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

• B4GalT2
• B4Gal-T2
• B4Gal-T3
• beta-1,4-Galactosyltransferase 2
• Beta-1,4-GalTase 2
• beta-4-GalT2
• beta4Gal-T2
• beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2
• EC 2.4.1.-
• UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2
• UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
• UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2
• UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2
• UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2

Background

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: B4GALT2
• Uniprot:
  • O60909(Human)