We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

Images

 
Western Blot: beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody [NBP1-59837] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free

  • B4GalT2
  • B4Gal-T2
  • B4Gal-T3
  • beta-1,4-Galactosyltransferase 2
  • Beta-1,4-GalTase 2
  • beta-4-GalT2
  • beta4Gal-T2
  • beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
  • UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2

Background

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene synthesizes N-acetyllactosamine in glycolipids and glycoproteins. Its substrate specificity is affected by alpha-lactalbumin but it is not expressed in lactating mammary tissue. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88653
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88654
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP1-59837) (0)

There are no publications for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP1-59837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP1-59837) (0)

There are no reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP1-59837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP1-59837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-1,4-Galactosyltransferase 2/B4GalT2 Products

Research Areas for beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody (NBP1-59837)

Find related products by research area.

Blogs on beta-1,4-Galactosyltransferase 2/B4GalT2

There are no specific blogs for beta-1,4-Galactosyltransferase 2/B4GalT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT2
Uniprot