beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody

Images

 
Western Blot: beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody [NBP1-59853] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody Summary

Immunogen
Synthetic peptides corresponding to B3GAT3 (beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I)) The peptide sequence was selected from the N terminal of B3GAT3)(50ug). Peptide sequence PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYV
Clonality
Polyclonal
Host
Rabbit
Gene
B3GAT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3GAT3 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody

  • beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I)
  • Beta-1,3-glucuronyltransferase 3
  • beta-1,3-Glucuronyltransferase 3/B3GAT3
  • EC 2.4.1.135
  • galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
  • GLCATI
  • GlcAT-I
  • GlcUAT-I
  • Glucuronosyltransferase I
  • Sqv-8-like protein
  • UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase

Background

The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88652
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33625
Species: Hu
Applications: IHC, IHC-P
NBP2-20841
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81851
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
H00055790-B02P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-80641
Species: Hu
Applications: IHC, IHC-P

Publications for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853) (0)

There are no publications for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853) (0)

There are no reviews for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-1,3-Glucuronyltransferase 3/B3GAT3 Products

Related Products by Gene

Bioinformatics Tool for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853)

Discover related pathways, diseases and genes to beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853)

Discover more about diseases related to beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853).
 

Pathways for beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody (NBP1-59853)

View related products by pathway.

Blogs on beta-1,3-Glucuronyltransferase 3/B3GAT3

There are no specific blogs for beta-1,3-Glucuronyltransferase 3/B3GAT3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol B3GAT3
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59853 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought