bcl10-interacting CARD protein Antibody - Azide and BSA Free

Western Blot: bcl10-interacting CARD protein Antibody [NBP2-92715] - Analysis of extracts of various cell lines, using bcl10-interacting CARD protein .Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

bcl10-interacting CARD protein Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3). MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CARD19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for bcl10-interacting CARD protein Antibody - Azide and BSA Free

• bA370F5.1
• bcl10-interacting CARD protein
• Bcl10-interacting protein with CARD
• BinCARD
• chromosome 9 open reading frame 89
• MGC110898
• MGC11115

Background

C9orf89 plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit thephosphorylation of BCL10 in a CARD-dependent manner

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: CARD19