bcl10-interacting CARD protein Antibody

Images

 
Immunohistochemistry-Paraffin: bcl10-interacting CARD protein Antibody [NBP1-88777] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

bcl10-interacting CARD protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C9ORF89
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
bcl10-interacting CARD protein Protein (NBP1-88777PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for bcl10-interacting CARD protein Antibody

  • bA370F5.1
  • bcl10-interacting CARD protein
  • Bcl10-interacting protein with CARD
  • BinCARD
  • chromosome 9 open reading frame 89
  • MGC110898
  • MGC11115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for bcl10-interacting CARD protein Antibody (NBP1-88777) (0)

There are no publications for bcl10-interacting CARD protein Antibody (NBP1-88777).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for bcl10-interacting CARD protein Antibody (NBP1-88777) (0)

There are no reviews for bcl10-interacting CARD protein Antibody (NBP1-88777). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for bcl10-interacting CARD protein Antibody (NBP1-88777) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional bcl10-interacting CARD protein Products

Bioinformatics Tool for bcl10-interacting CARD protein Antibody (NBP1-88777)

Discover related pathways, diseases and genes to bcl10-interacting CARD protein Antibody (NBP1-88777). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for bcl10-interacting CARD protein Antibody (NBP1-88777)

Find related products by research area.

Blogs on bcl10-interacting CARD protein

There are no specific blogs for bcl10-interacting CARD protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our bcl10-interacting CARD protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C9ORF89