BBSome Interacting Protein 1 Antibody

Images

 
Immunohistochemistry: BBSome Interacting Protein 1 Antibody [NBP2-30510] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BBSome Interacting Protein 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BBIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BBSome Interacting Protein 1 Protein (NBP2-30510PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BBSome Interacting Protein 1 Antibody

  • bA348N5.3
  • BBIP1
  • BBIP10
  • BBSome-Interacting Protein 1
  • BBSome-Interacting Protein Of 10 KDa
  • NCRNA00081
  • Non-Protein Coding RNA 81
  • UPF0604 Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NBP1-91695
Species: Hu
Applications: IHC, IHC-P

Publications for BBSome Interacting Protein 1 Antibody (NBP2-30510) (0)

There are no publications for BBSome Interacting Protein 1 Antibody (NBP2-30510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBSome Interacting Protein 1 Antibody (NBP2-30510) (0)

There are no reviews for BBSome Interacting Protein 1 Antibody (NBP2-30510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BBSome Interacting Protein 1 Antibody (NBP2-30510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BBSome Interacting Protein 1 Products

Bioinformatics Tool for BBSome Interacting Protein 1 Antibody (NBP2-30510)

Discover related pathways, diseases and genes to BBSome Interacting Protein 1 Antibody (NBP2-30510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BBSome Interacting Protein 1

There are no specific blogs for BBSome Interacting Protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BBSome Interacting Protein 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BBIP1
Uniprot