B3GNT7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: B3GNT7 Antibody [NBP1-88659] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: B3GNT7 Antibody [NBP1-88659] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GNT7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
B3GNT7 Protein (NBP1-88659PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GNT7 Antibody

  • beta 1,3-N-acetylglucosaminyltransferase 7
  • Beta-1,3-Gn-T7
  • Beta-1,3-N-acetylglucosaminyltransferase 7
  • beta3GnT7
  • beta3Gn-T7
  • BGnT-7
  • EC 2.4.1
  • EC 2.4.1.-
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5316
Species: Hu
Applications: WB
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-62277
Species: Hu
Applications: WB
NBP1-89009
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45527
Species: Hu
Applications: WB, IHC, IF
NBP1-88659
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for B3GNT7 Antibody (NBP1-88659) (0)

There are no publications for B3GNT7 Antibody (NBP1-88659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GNT7 Antibody (NBP1-88659) (0)

There are no reviews for B3GNT7 Antibody (NBP1-88659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for B3GNT7 Antibody (NBP1-88659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GNT7 Products

Bioinformatics Tool for B3GNT7 Antibody (NBP1-88659)

Discover related pathways, diseases and genes to B3GNT7 Antibody (NBP1-88659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GNT7 Antibody (NBP1-88659)

Discover more about diseases related to B3GNT7 Antibody (NBP1-88659).
 

Pathways for B3GNT7 Antibody (NBP1-88659)

View related products by pathway.

Blogs on B3GNT7

There are no specific blogs for B3GNT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GNT7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT7