B3GALT2 Antibody (1D9)

Images

 
Immunocytochemistry/ Immunofluorescence: B3GALT2 Antibody (1D9) [H00008707-M03] - Analysis of monoclonal antibody to B3GALT2 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
1D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

B3GALT2 Antibody (1D9) Summary

Immunogen
B3GALT2 (NP_003774 324 a.a. - 422 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
B3GALT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B3GALT2 Antibody (1D9)

  • beta-1,3-galactosyltransferase 2
  • Beta-1,3-GalTase 2
  • Beta3GalT2
  • beta-3-galt2
  • beta3Gal-T2
  • EC 2.4.1
  • EC 2.4.1.-
  • GLCT2
  • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
  • UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2

Background

This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes a protein that functions in N-linked glycoprotein glycosylation and shows strict donor substrate specificity for UDP-galactose.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69327
Species: Hu
Applications: WB
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NB200-184
Species: Hu, Mu
Applications: WB, IP
NBP1-90040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30879
Species: Hu
Applications: IHC, IHC-P
H00008707-M03
Species: Hu
Applications: ELISA, ICC/IF

Publications for B3GALT2 Antibody (H00008707-M03) (0)

There are no publications for B3GALT2 Antibody (H00008707-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALT2 Antibody (H00008707-M03) (0)

There are no reviews for B3GALT2 Antibody (H00008707-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for B3GALT2 Antibody (H00008707-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALT2 Products

Bioinformatics Tool for B3GALT2 Antibody (H00008707-M03)

Discover related pathways, diseases and genes to B3GALT2 Antibody (H00008707-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GALT2 Antibody (H00008707-M03)

Discover more about diseases related to B3GALT2 Antibody (H00008707-M03).

Blogs on B3GALT2

There are no specific blogs for B3GALT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALT2 Antibody (1D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALT2
Uniprot