ATP8B2 Antibody

Images

 
Immunohistochemistry: ATP8B2 Antibody [NBP2-30486] - Staining of human duodenum shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP8B2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP8B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP8B2 Protein (NBP2-30486PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP8B2 Antibody

  • ATPase, class I, type 8B, member 2
  • ATPIDprobable phospholipid-transporting ATPase ID
  • DKFZp434M0219
  • EC 3.6.3
  • EC 3.6.3.1
  • KIAA1137ATPase class I type 8B member 2
  • phospholipid-transporting ATPase ID

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

46770002
Species: Hu
Applications: ELISA
NBP2-05627
Species: Hu
NBP1-85718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP1-88907
Species: Hu
Applications: IHC, IHC-P
NBP2-30486
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ATP8B2 Antibody (NBP2-30486) (0)

There are no publications for ATP8B2 Antibody (NBP2-30486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP8B2 Antibody (NBP2-30486) (0)

There are no reviews for ATP8B2 Antibody (NBP2-30486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP8B2 Antibody (NBP2-30486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP8B2 Products

Bioinformatics Tool for ATP8B2 Antibody (NBP2-30486)

Discover related pathways, diseases and genes to ATP8B2 Antibody (NBP2-30486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP8B2 Antibody (NBP2-30486)

Discover more about diseases related to ATP8B2 Antibody (NBP2-30486).
 

Pathways for ATP8B2 Antibody (NBP2-30486)

View related products by pathway.

PTMs for ATP8B2 Antibody (NBP2-30486)

Learn more about PTMs related to ATP8B2 Antibody (NBP2-30486).

Blogs on ATP8B2

There are no specific blogs for ATP8B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP8B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP8B2
Uniprot