ARMC9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARMC9 Antibody [NBP1-88991] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: ARMC9 Antibody [NBP1-88991] - Staining of human vulva/anal skin shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMC9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARMC9 Protein (NBP1-88991PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMC9 Antibody

  • ARM
  • armadillo repeat containing 9
  • armadillo/beta-catenin-like repeats
  • FLJ12584
  • KIAA1868
  • KU-MEL-1
  • lisH domain-containing protein ARMC9
  • melanoma/melanocyte specific protein KU-MEL-1
  • Melanoma/melanocyte-specific tumor antigen KU-MEL-1
  • NS21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85394
Species: Hu
Applications: IHC, IHC-P
NBP1-88991
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ARMC9 Antibody (NBP1-88991) (0)

There are no publications for ARMC9 Antibody (NBP1-88991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMC9 Antibody (NBP1-88991) (0)

There are no reviews for ARMC9 Antibody (NBP1-88991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARMC9 Antibody (NBP1-88991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMC9 Products

Bioinformatics Tool for ARMC9 Antibody (NBP1-88991)

Discover related pathways, diseases and genes to ARMC9 Antibody (NBP1-88991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ARMC9

There are no specific blogs for ARMC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC9
Entrez
Uniprot