ARMC1 Antibody - BSA Free

Western Blot: ARMC1 Antibody [NBP1-88847] - Analysis in control (vector only transfected HEK293T lysate) and ARMC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ARMC1 Antibody [NBP1-88847] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: ARMC1 Antibody [NBP1-88847] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Western Blot: ARMC1 Antibody [NBP1-88847] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: ARMC1 Antibody [NBP1-88847] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: ARMC1 Antibody [NBP1-88847] -Staining of human cerebellum shows moderate to strong cytoplasmic positivity in a subset of cells cells in granular layer.

Immunohistochemistry-Paraffin: ARMC1 Antibody [NBP1-88847] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ARMC1 Antibody [NBP1-88847] -Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARMC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARMC1 Antibody - BSA Free (NBP1-88847) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRA
• Predicted Species: Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARMC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARMC1 Protein (NBP1-88847PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARMC1 Antibody - BSA Free

• Arcp
• armadillo repeat containing 1
• armadillo repeat-containing protein 1
• FLJ10511

Background

ARMC1( AAH11607, 1 a.a. - 283 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARMC1
• Entrez:
  • 55156(Human)
• Uniprot:
  • Q9NVT9(Human)