ARHGAP30 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARHGAP30 Antibody [NBP1-84653] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: ARHGAP30 Antibody [NBP1-84653] - Staining of human tonsil shows moderate cytoplasmic positivity in reaction center cells while strong staining in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSGSRSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGAP30 Protein (NBP1-84653PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP30 Antibody

  • Rho GTPase activating protein 30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13230
Species: Hu
Applications: IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGAP30 Antibody (NBP1-84653) (0)

There are no publications for ARHGAP30 Antibody (NBP1-84653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP30 Antibody (NBP1-84653) (0)

There are no reviews for ARHGAP30 Antibody (NBP1-84653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGAP30 Antibody (NBP1-84653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGAP30 Products

Bioinformatics Tool for ARHGAP30 Antibody (NBP1-84653)

Discover related pathways, diseases and genes to ARHGAP30 Antibody (NBP1-84653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP30 Antibody (NBP1-84653)

Discover more about diseases related to ARHGAP30 Antibody (NBP1-84653).
 

Pathways for ARHGAP30 Antibody (NBP1-84653)

View related products by pathway.

Blogs on ARHGAP30

There are no specific blogs for ARHGAP30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP30
Entrez
Uniprot