ANO7 Recombinant Protein Antigen

Images

 
There are currently no images for ANO7 Protein (NBP1-83099PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ANO7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANO7.

Source: E.coli

Amino Acid Sequence: VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANO7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83099.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ANO7 Recombinant Protein Antigen

  • ANO7
  • Anoctamin 7
  • Dresden transmembrane protein of the prostate
  • DTMPP
  • IPCA-5IPCA5
  • New gene expressed in prostate
  • NGEP
  • NGEPD-TMPP
  • PCANAP5
  • PCANAP5anoctamin-7
  • PCANAP5L
  • prostate cancer associated protein 5
  • prostate cancer-associated gene 5
  • Prostate cancer-associated protein 5
  • TMEM16G
  • TMEM16GDresden-transmembrane protein of the prostate
  • Transmembrane protein 16GDTMPP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74204
Species: Mu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-92462
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24552
Species: Hu, Mu, Pm
Applications: WB, Simple Western, IHC-P
NBP1-77112
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-90507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87936
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-68732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-59355
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ANO7 Protein (NBP1-83099PEP) (0)

There are no publications for ANO7 Protein (NBP1-83099PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANO7 Protein (NBP1-83099PEP) (0)

There are no reviews for ANO7 Protein (NBP1-83099PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ANO7 Protein (NBP1-83099PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP1-83099PEP

Bioinformatics Tool for ANO7 Protein (NBP1-83099PEP)

Discover related pathways, diseases and genes to ANO7 Protein (NBP1-83099PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANO7 Protein (NBP1-83099PEP)

Discover more about diseases related to ANO7 Protein (NBP1-83099PEP).
 

Pathways for ANO7 Protein (NBP1-83099PEP)

View related products by pathway.

PTMs for ANO7 Protein (NBP1-83099PEP)

Learn more about PTMs related to ANO7 Protein (NBP1-83099PEP).

Blogs on ANO7

There are no specific blogs for ANO7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
ANO7 Antibody
NBP1-83099
CD97 Antibody
NBP2-24552

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ANO7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANO7
Entrez