alpha-N-terminal Methyltransferase 1A/METTL11A Antibody

Western Blot: alpha-N-terminal Methyltransferase 1A/METTL11A Antibody [NBP1-89255] - Analysis in control (vector only transfected HEK293T lysate) and NTMT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: alpha-N-terminal Methyltransferase 1A/METTL11A Antibody [NBP1-89255] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: alpha-N-terminal Methyltransferase 1A/METTL11A Antibody [NBP1-89255] - Staining of human adrenal gland shows cytoplasmic positivity in cortical cells.

Product Discontinued

alpha-N-terminal Methyltransferase 1A/METTL11A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYS
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NTMT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody

• AD-003
• alpha N-terminal protein methyltransferase 1A
• C9orf32
• chromosome 9 open reading frame 32
• EC 2.1.1.-
• methyltransferase like 11A
• Methyltransferase-like protein 11A
• METTL11A
• NRMT
• N-terminal RCC1 methyltransferase
• NTM1A
• NTMT1
• X-Pro-Lys N-terminal protein methyltransferase 1A

Background

Probable S-adenosyl-L-methionine-dependent methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NTMT1