alpha-N-terminal Methyltransferase 1A/METTL11A Antibody

Images

 
Western Blot: alpha-N-terminal Methyltransferase 1A/METTL11A Antibody [NBP1-89255] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunocytochemistry/ Immunofluorescence: alpha-N-terminal Methyltransferase 1A/METTL11A Antibody [NBP1-89255] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: alpha-N-terminal Methyltransferase 1A/METTL11A Antibody [NBP1-89255] - Staining of human adrenal gland shows cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-N-terminal Methyltransferase 1A/METTL11A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alpha-N-terminal Methyltransferase 1A/METTL11A Protein (NBP1-89255PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody

  • AD-003
  • alpha N-terminal protein methyltransferase 1A
  • C9orf32
  • chromosome 9 open reading frame 32
  • EC 2.1.1.-
  • methyltransferase like 11A
  • Methyltransferase-like protein 11A
  • METTL11A
  • NRMT
  • N-terminal RCC1 methyltransferase
  • NTM1A
  • NTMT1
  • X-Pro-Lys N-terminal protein methyltransferase 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84123
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255) (0)

There are no publications for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255) (0)

There are no reviews for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-N-terminal Methyltransferase 1A/METTL11A Products

Bioinformatics Tool for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255)

Discover related pathways, diseases and genes to alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255)

View related products by pathway.

PTMs for alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255)

Learn more about PTMs related to alpha-N-terminal Methyltransferase 1A/METTL11A Antibody (NBP1-89255).

Blogs on alpha-N-terminal Methyltransferase 1A/METTL11A

There are no specific blogs for alpha-N-terminal Methyltransferase 1A/METTL11A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-N-terminal Methyltransferase 1A/METTL11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTMT1
Entrez