![Western Blot: Adenylate Kinase 8 Antibody [NBP1-88244] - Analysis in control (vector only transfected HEK293T lysate) and AK8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/C9orf98-Antibody-Western-Blot-NBP1-88244-img0008.jpg "Western Blot: Adenylate Kinase 8 Antibody [NBP1-88244] - Analysis in control (vector only transfected HEK293T lysate) and AK8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AK8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AK8 |
![Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining in human fallopian tube and skeletal muscle tissues using anti-AK8 antibody. Corresponding AK8 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/C9orf98-Antibody-Immunohistochemistry-Paraffin-NBP1-88244-img0007.jpg "Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining in human fallopian tube and skeletal muscle tissues using anti-AK8 antibody. Corresponding AK8 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.](http://images.novusbio.com/fullsize/C9orf98-Antibody-Immunohistochemistry-Paraffin-NBP1-88244-img0002.jpg "Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.")
![Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/C9orf98-Antibody-Immunohistochemistry-Paraffin-NBP1-88244-img0005.jpg "Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/C9orf98-Antibody-Immunohistochemistry-Paraffin-NBP1-88244-img0006.jpg "Immunohistochemistry-Paraffin: Adenylate Kinase 8 Antibody [NBP1-88244] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry Frizzled-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Frizzled-3_AF1001_Immunohistochemistry_9912.jpg)
![Frizzled-9 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Frizzled-9 Antibody [Unconjugated]")
