Recombinant Human Adenylate Cyclase 2 Protein

Images

 
SDS-Page: Recombinant Human Adenylate Cyclase 2 Protein [H00000108-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Adenylate Cyclase 2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human ADCY2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADCY2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenylate Cyclase 2 Protein

  • 3'-5'-cyclic AMP synthetase
  • AC2
  • adenylate cyclase 2 (brain)
  • adenylate cyclase II
  • adenylate cyclase type 2
  • Adenylate cyclase type II
  • Adenylyl cyclase 2
  • ATP pyrophosphate-lyase 2
  • EC 4.6.1.1
  • FLJ45092
  • HBAC2
  • KIAA1060FLJ16822
  • MGC133314
  • type II adenylate cyclase

Background

ADCY2 - adenylate cyclase 2 (brain)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
H00010141-P01
Species: Hu
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-37920
Species: Hu
Applications: IHC, IHC-P
NBP1-59023
Species: Hu
Applications: WB
NBP1-90279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90278
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30380
Species: Hu
Applications: IHC, IHC-P
NBP2-15294
Species: Hu, Mu
Applications: WB
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01) (0)

There are no publications for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01) (0)

There are no reviews for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenylate Cyclase 2 Products

Bioinformatics Tool for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01)

Discover related pathways, diseases and genes to Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01)

Discover more about diseases related to Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01).
 

Pathways for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01)

View related products by pathway.

PTMs for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01)

Learn more about PTMs related to Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01).
 

Research Areas for Adenylate Cyclase 2 Partial Recombinant Protein (H00000108-Q01)

Find related products by research area.

Blogs on Adenylate Cyclase 2

There are no specific blogs for Adenylate Cyclase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adenylate Cyclase 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCY2