![Western Blot: ADAMTSL5 Antibody [NBP1-93438] - Analysis in human cell line CACO-2.](http://images.novusbio.com/fullsize/ADAMTSL5-Antibody-Western-Blot-NBP1-93438-img0008.jpg "Western Blot: ADAMTSL5 Antibody [NBP1-93438] - Analysis in human cell line CACO-2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADAMTSL5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ADAMTSL5 Antibody [NBP1-93438] - ADAMTSL5 distribution and co-localization with melanocytes. Representative double immunofluorescence images of ADAMTSL5 made in rabbit (A), in psoriasis lesional skin confirming expression of ADAMTSL5 in keratinocytes and co-localization of ADAMTSL5 with melanocytes (Melan-A). Cells that co-express the two markers in a similar location are yellow in color. White line denotes the junction between epidermis and the dermis. Size bar = 100um. Image collected and cropped by CiteAb from the following publication (hilarispublisher.com/open-access/cutaneous-expression-of-a-disintegrinlike-and-metalloprotease-domaincontaining-thrombospondin-type-1-motiflike-5-adamtsl5-in-psori-2376-0427-1000244.pdf), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ADAMTSL5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93438-img0007.jpg "Immunocytochemistry/Immunofluorescence: ADAMTSL5 Antibody [NBP1-93438] - ADAMTSL5 distribution and co-localization with melanocytes. Representative double immunofluorescence images of ADAMTSL5 made in rabbit (A), in psoriasis lesional skin confirming expression of ADAMTSL5 in keratinocytes and co-localization of ADAMTSL5 with melanocytes (Melan-A). Cells that co-express the two markers in a similar location are yellow in color. White line denotes the junction between epidermis and the dermis. Size bar = 100um. Image collected and cropped by CiteAb from the following publication (hilarispublisher.com/open-access/cutaneous-expression-of-a-disintegrinlike-and-metalloprotease-domaincontaining-thrombospondin-type-1-motiflike-5-adamtsl5-in-psori-2376-0427-1000244.pdf), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: ADAMTSL5 Antibody [NBP1-93438] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ADAMTSL5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93438-img0006.jpg "Immunocytochemistry/Immunofluorescence: ADAMTSL5 Antibody [NBP1-93438] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry: ADAMTSL5 Antibody [NBP1-93438] - Distribution of ADAMTSL5 in nonlesional & lesional psoriatic skin Representative images for immunohistochemistry staining of ADAMTSL5, Melan-A, & K16 in psoriasis nonlesional & lesional skin. There is widespread distribution & expression of ADAMTSL5 raised in goat, rabbit, & chicken in keratinocytes, melanocytes, blood vessels & dermal cells (A). The staining pattern is similar to melanocytes (Melan A) in the basal layer of the epidermis (B) & keratinocytes stained by K16 (C). The blue arrows indicate ADAMTSL5 expression in melanocytes in lesional psoriatic skin. Size bar = 100um. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27857980), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-93438_rabbit-polyclonal-adamtsl5-antibody-310202415291999.jpg "Immunohistochemistry: ADAMTSL5 Antibody [NBP1-93438] - Distribution of ADAMTSL5 in nonlesional & lesional psoriatic skin Representative images for immunohistochemistry staining of ADAMTSL5, Melan-A, & K16 in psoriasis nonlesional & lesional skin. There is widespread distribution & expression of ADAMTSL5 raised in goat, rabbit, & chicken in keratinocytes, melanocytes, blood vessels & dermal cells (A). The staining pattern is similar to melanocytes (Melan A) in the basal layer of the epidermis (B) & keratinocytes stained by K16 (C). The blue arrows indicate ADAMTSL5 expression in melanocytes in lesional psoriatic skin. Size bar = 100um. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27857980), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")