![Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/ACSM4-Antibody-Immunohistochemistry-Paraffin-NBP2-14696-img0001.jpg "Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNF AADV |
| Specificity | Specificity of human ACSM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACSM4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Human | 04/23/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ACSM4 Antibody (NBP2-14696)Discover more about diseases related to ACSM4 Antibody (NBP2-14696).
| Pathways for ACSM4 Antibody (NBP2-14696)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: PECI Antibody [NBP1-89283] - Analysis using Anti-ECI2 antibody NBP1-89283 (A) shows similar pattern to independent antibody NBP2-48614 (B).](http://images.novusbio.com/images2/PECI-Antibody-Western-Blot-NBP1-89283-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: PECI Antibody [NBP1-89283] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & vesicles.](http://images.novusbio.com/images2/PECI-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89283-img0006.jpg)
![Immunohistochemistry-Paraffin: PECI Antibody [NBP1-89283] - Staining of human kidney using Anti-ECI2 antibody NBP1-89283.](http://images.novusbio.com/images2/PECI-Antibody-Immunohistochemistry-Paraffin-NBP1-89283-img0017.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")