![Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/ACSM4-Antibody-Immunohistochemistry-Paraffin-NBP2-14696-img0001.jpg "Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNF AADV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACSM4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 04/23/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ACSM4 Antibody (NBP2-14696)Discover more about diseases related to ACSM4 Antibody (NBP2-14696).
| Pathways for ACSM4 Antibody (NBP2-14696)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PECI Antibody [NBP1-89283] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & vesicles.](http://images.novusbio.com/images2/PECI-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89283-img0006.jpg)
![Immunohistochemistry-Paraffin: PECI Antibody [NBP1-89283] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/images2/PECI-Antibody-Immunohistochemistry-Paraffin-NBP1-89283-img0008.jpg)
![Immunohistochemistry-Paraffin: PECI Antibody [NBP1-89283] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/images2/PECI-Antibody-Immunohistochemistry-Paraffin-NBP1-89283-img0009.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
