ACSM4 Antibody


Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ACSM4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNF AADV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACSM4 Protein (NBP2-14696PEP)
Reviewed Applications
Read 1 Review rated 3
NBP2-14696 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ACSM4 Antibody

  • ACSM4 acyl-CoA synthetase medium-chain family member 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P

Publications for ACSM4 Antibody (NBP2-14696) (0)

There are no publications for ACSM4 Antibody (NBP2-14696).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ACSM4 Antibody (NBP2-14696) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-14696:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot ACSM4 NBP2-14696
reviewed by:
Verified Customer
WB Human 04/23/2018


ApplicationWestern Blot
Sample TestedABCG1 transfected HEK293 cell lysate and controls (untransfected cells)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACSM4 Antibody (NBP2-14696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ACSM4 Products

Array NBP2-14696

Bioinformatics Tool for ACSM4 Antibody (NBP2-14696)

Discover related pathways, diseases and genes to ACSM4 Antibody (NBP2-14696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSM4 Antibody (NBP2-14696)

Discover more about diseases related to ACSM4 Antibody (NBP2-14696).

Pathways for ACSM4 Antibody (NBP2-14696)

View related products by pathway.

Blogs on ACSM4

There are no specific blogs for ACSM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: WB
Species: Human


Gene Symbol ACSM4