![Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/ACSM4-Antibody-Immunohistochemistry-Paraffin-NBP2-14696-img0001.jpg "Immunohistochemistry-Paraffin: ACSM4 Antibody [NBP2-14696] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNF AADV |
| Specificity | Specificity of human ACSM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACSM4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Human | 04/23/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ACSM4 Antibody (NBP2-14696)Discover more about diseases related to ACSM4 Antibody (NBP2-14696).
| Pathways for ACSM4 Antibody (NBP2-14696)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: PECI Antibody [NBP1-89283] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/PECI-Antibody-Western-Blot-NBP1-89283-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: PECI Antibody [NBP1-89283] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & vesicles.](http://images.novusbio.com/fullsize2/PECI-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89283-img0006.jpg)
![Immunohistochemistry-Paraffin: PECI Antibody [NBP1-89283] - Staining of human skin shows very weak positivity in epidermal cells.](http://images.novusbio.com/fullsize2/PECI-Antibody-Immunohistochemistry-Paraffin-NBP1-89283-img0010.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")